| Intro
Home Page
Contact Me
Cool Links
Ask Reverend Justin
Goodtimist Philosophy
Guest Book
Humor
Membership and Clergy
Art and Such
About
|
|
Problems with the creationists' "it's so improbable" calculations (Thanks to the folks at TalkOrigins)
1) They calculate the probability of the formation of a "modern" protein, or even a complete bacterium with all "modern" proteins, by random events. This is not the abiogenesis theory at all.
2) They assume that there is a fixed number of proteins, with fixed sequences for each protein, that are required for life.
3) They calculate the probability of sequential trials, rather than simultaneous trials.
4) They misunderstand what is meant by a probability calculation.
5) They seriously underestimate the number of functional enzymes/ribozymes present in a group of random sequences.
Your entire premise is incorrect to start off with, because in modern abiogenesis theories the first "living things" would be much simpler, not even a protobacteria, or a preprotobacteria, but one or more simple molecules probably not more than 30-40 subunits long. These simple molecules then slowly evolved into more cooperative self-replicating systems, then finally into simple organisms.
The first "living things" could have been a single self replicating molecule, similar to the "self-replicating" peptide from the Ghadiri group, or the self replicating hexanucleotide, or possibly an RNA polymerase that acts on itself.
No matter whether the first self-replicators were single molecules, or complexes of small molecules, this model is nothing like Hoyle's "tornado in a junkyard making a 747" that is popularly (and mistakenly) used. Here is a simple comparison of the theory criticised by creationists, and the actual theory of abiogenesis, provided by TalkOrigins.

Note that the real theory has a number of small steps, and in fact I've left out some steps (especially between the hypercycle-protobiont stage) for simplicity. Each step is associated with a small increase in organisation and complexity, and the chemicals slowly climb towards organism-hood, rather than making one big leap.
Where the creationist idea that modern organisms form spontaneously comes from is not certain. The first modern abiogenesis formulation, the Oparin/Haldane hypothesis from the 20's, starts with simple proteins/proteinoids developing slowly into cells. Even the ideas circulating in the 1850's were not "spontaneous" theories.
Even though creationists are criticizing a theory which is 150 years out of date, and held by no modern evolutionary biologists, it is necessary to go further into argument because of fundamental mistakes in statistics and biochemistry that continually turn up in some of these mistaken "refutations".
The myth of "life sequence"
The following topic is handled perfectly by the Talk Origins archive, and thus I will use their explanation:
"Another claim often heard is that there is a "life sequence" of 400 proteins, and that the amino acid sequences of these proteins cannot be changed, for organisms to be alive. This, however, is nonsense. The 400 protein claim seems to come from the protein coding genome of Mycobacterium genetalium, which has the smallest genome currently known of any modern organism. However, inspection of the genome suggests that this could be reduced further to a minimal gene set of 256 proteins. Note again that this is a modern organism. The first protobiont/progenote would have been smaller still, and preceded by even simpler chemical systems.
As to the claim that the sequences of proteins cannot be changed, again this is nonsense. There are in most proteins regions where almost any amino acid can be substituted, and other regions where conservative substitutions (where charged amino acids can be swapped with other charged amino acids, neutral for other neutral amino acids and hydrophobic amino acids for other hydrophobic amino acids) can be made. Some functionally equivalent molecules can have between 30 - 50% of their amino acids different. In fact it is possible to substitute structurally non-identical bacterial proteins for yeast proteins, and worm proteins for human proteins, and the organisms live quite happily.
The "life sequence" is a myth."
Coin tossing for beginners and macromolecular assembly...
Again TalkOrigins is saving me some time from writing out what is basic knowledge in Statistics, but which has been horribly misconstrued by Creationism.
"So let's play the creationist game and look at forming a peptide by random addition of amino acids. This certainly is not the way peptides formed on the early Earth, but it will be instructive.
I will use as an example the "self-replicating" peptide from the Ghadiri group mentioned above. I could use other examples, such as the hexanucleotide self-replicator, the SunY self-replicator or the RNA polymerase described by the Eckland group, but for historical continuity with creationist claims a small peptide is ideal. This peptide is 32 amino acids long with a sequence of RMKQLEEKVYELLSKVACLEYEVARLKKVGE and is an enzyme, a peptide ligase that makes a copy of itself from two 16 amino acid long subunits. It is also of a size and composition that is ideally suited to be formed by abiotic peptide synthesis. The fact that it is a self replicator is an added irony.
The probability of generating this in successive random trials is (1/20)^32 or 1 chance in 4.29 x 10^40. This is much, much more probable than the 1 in 2.04 x 10^390 of the standard creationist "generating carboxypeptidase by chance" scenario, but still seems absurdly low.
However, there is another side to these probability estimates, and it hinges on the fact that most of us don't have a feeling for statistics. When someone tells us that some event has a one in a million chance of occuring, many of us expect that one million trials must be undergone before the said event turns up, but this is wrong.
Here is a experiment you can do yourself: take a coin, flip it four times, write down the results, and then do it again. How many times would you think you had to repeat this procedure (trial) before you get 4 heads in a row?
Now the probability of 4 heads in a row is is (1/2)^4 or 1 chance in 16: do we have to do 16 trials to get 4 heads (HHHH)? No, in successive experiments I got 11, 10, 6, 16, 1, 5, and 3 trials before HHHH turned up. The figure 1 in 16 (or 1 in a million or 1 in 10^40) gives the likelihood of an event in a given trial, but doesn't say where it will occur in a series. You can flip HHHH on your very first trial (I did). Even at 1 chance in 4.29 x 10^40, a self-replicator could have turned up surprisingly early. But there is more.
1 chance in 4.29 x 10^40 is still orgulously, gobsmackingly unlikely; it's hard to cope with this number. Even with the argument above (you could get it on your very first trial) most people would say "surely it would still take more time than the Earth existed to make this replicator by random methods". Not really; in the above examples we were examining sequential trials, as if there was only one protein/DNA/proto-replicator being assembled per trial. In fact there would be billions of simultaneous trials as the billions of building block molecules interacted in the oceans, or on the thousands of kilometers of shorelines that could provide catalytic surfaces or templates.
Let's go back to our example with the coins. Say it takes a minute to toss the coins 4 times; to generate HHHH would take on average 8 minutes. Now get 16 friends, each with a coin, to all flip the coin simultaneously 4 times; the average time to generate HHHH is now 1 minute. Now try to flip 6 heads in a row; this has a probability of (1/2)^6 or 1 in 64. This would take half an hour on average, but go out and recruit 64 people, and you can flip it in a minute. If you want to flip a sequence with a chance of 1 in a billion, just recruit the population of China to flip coins for you, you will have that sequence in no time flat.
So, if on our prebiotic earth we have a billion peptides growing simultaneously, that reduces the time taken to generate our replicator significantly.
Okay, you are looking at that number again, 1 chance in 4.29 x 10^40, that's a big number, and although a billion starting molecules is a lot of molecules, could we ever get enough molecules to randomly assemble our first replicator in under half a billion years?
Yes, one kilogram of the amino acid arginine has 2.85 x 10^24 molecules in it (that's well over a billion billion); a tonne of arginine has 2.85 x 10^27 molecules. If you took a semi-trailer load of each amino acid and dumped it into a medium size lake, you would have enough molecules to generate our particular replicator in a few tens of years, given that you can make 55 amino acid long proteins in 1 to 2 weeks.
So how does this shape up with the prebiotic Earth? On the early Earth it is likely that the ocean had a volume of 1 x 10^24 litres. Given an amino acid concentration of 1 x 10^-6 M (a moderately dilute soup, see Chyba and Sagan 1992), then there are roughly 1 x 10^50 potential starting chains, so that a fair number of efficent peptide ligases (about 1 x 10^31) could be produced in a under a year, let alone a million years. The synthesis of primitive self-replicators could happen relatively rapidly, even given a probability of 1 chance in 4.29 x 10^40 (and remember, our replicator could be synthesized on the very first trial).
Assume that it takes a week to generate a sequence. Then the Ghadiri ligase could be generated in one week, and any cytochrome C sequence could be generated in a bit over a million years (along with about half of all possible 101 peptide sequences, a large proportion of which will be functional proteins of some sort).
Although I have used the Ghadiri ligase as an example, as I mentioned above the same calculations can be performed for the SunY self replicator, or the Ekland RNA polymerase. I leave this as an exercise for the reader, but the general conclusion (you can make scads of the things in a short time) is the same for these oligonucleotides."
Enzymes and Ribozymes
The analysis by Ekland that was mentioned above by TalkOrigins suggests that in the sequence space of 220 nucleotide long RNA sequences, a staggering 2.5 x 10^112 sequences are efficent molecular ligases. Going back to our primitive ocean of 1 x 10^24 litres and assuming a nucleotide concentration of 1 x 10^-7 M (Chyba and Sagan), then there are roughly 1 x 10^49 potential nucleotide chains, so that a fair number of efficent RNA ligases (about 1 x 10^34) could be produced in a single year, let alone a million years. The potential number of RNA polymerases is high also; about 1 in every 10^20 sequences is an RNA polymerase.
Of the 1 x 10^130 possible 100 unit proteins, "3.8 x 10^61 represent cytochrome C" alone. (Yockey 1977) There are plenty of functional enyzmes in the peptide/nucleotide search space, so it would seem likely that a functioning group of enzymes could be brewed up in the prebiotic soup of early Earth.
Finishing Blow
The basis of creationists' probability calculations is incorrect from the start, as it aims at the wrong theory. Also, an incredible number of statistical and biological fallacies are to be found.
Since, at the moment, we have no idea how probable 'life' is, it's virtually impossible to assign any valuable probabilities to any of the steps to life except the first two "(monomers to polymers p=1.0, formation of catalytic polymers p=1.0)" (ref: above).
In the end, life's feasibility depends on chemistry and biochemistry that we are still studying, not probabilities similar to coin flipping.
| |